PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim02g080740.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 278aa    MW: 31985.5 Da    PI: 10.2615
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim02g080740.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.58.2e-304092254
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYR 54
                        prlrWt++LH rFv +ve+LGG ++AtPk++l++m+vkgLt++h+kSHLQ+Y+
  Sopim02g080740.0.1 40 PRLRWTHDLHCRFVYVVERLGGVDRATPKRVLQIMDVKGLTISHIKSHLQMYK 92
                        8***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-283695IPR009057Homeodomain-like
SuperFamilySSF466896.63E-143993IPR009057Homeodomain-like
TIGRFAMsTIGR015573.9E-224093IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MMKGLEFSEN SPSLSMELEY RSNDKSSEFA IRTYVKSTMP RLRWTHDLHC RFVYVVERLG  60
GVDRATPKRV LQIMDVKGLT ISHIKSHLQM YKNMKHQEMQ AEAANGKKRN RIDGSDSMNI  120
PQRNLVRRHN HIKGKAAMFD GSDRMNFPQR NLVHRYNHIK SKAAMFDGSD QMNFSQGNLV  180
HCYNHNNGKA PIFNGSDEMN FPQGNLVHRY NHNNGKSVFD GYLNPTVTTN YLDKIPSSST  240
AFPPPWFVSF FFSFFFLLKM GTILSVNTFY IINVVIT*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010316584.10.0PREDICTED: uncharacterized protein LOC104645794 isoform X2
RefseqXP_010316583.10.0PREDICTED: uncharacterized protein LOC104645794 isoform X1
RefseqXP_010316582.10.0PREDICTED: uncharacterized protein LOC104645794 isoform X1
TrEMBLK4B9U50.0K4B9U5_SOLLC; Uncharacterized protein
STRINGSolyc02g080740.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13843412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42660.11e-26G2-like family protein